General Information

  • ID:  hor006290
  • Uniprot ID:  Q6BEG7
  • Protein name:  Obestatin
  • Gene name:  GHRL
  • Organism:  Capra hircus (Goat)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Capra (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0030296 protein tyrosine kinase activator activity; GO:0031768 ghrelin receptor binding
  • GO BP:  GO:0001937 negative regulation of endothelial cell proliferation; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008154 actin polymerization or depolymerization; GO:0009725 response to hormone; GO:0016358 dendrite development; GO:0032024 positive regulation of insulin secretion; GO:0032095 regulation of response to food; GO:0032097 positive regulation of response to food; GO:0032691 negative regulation of interleukin-1 beta production; GO:0032715 negative regulation of interleukin-6 production; GO:0032720 negative regulation of tumor necrosis factor production; GO:0042127 regulation of cell population proliferation; GO:0043066 negative regulation of apoptotic process; GO:0043410 positive regulation of MAPK cascade
  • GO CC:  NA

Sequence Information

  • Sequence:  FNAPFNIGIKLSGAQSLQHGQTL
  • Length:  23
  • Propeptide:  MPAPRTICSLLLLSMLWMDLAMAGSSFLSPEHQKLQRKEPKKPSGRLKPRALEGQFDPDVGSQEEGAEDELEIRFNAPFNIGIKLSGAQSLQHGQTLGKFLQDILWEEAEETLADE
  • Signal peptide:  MPAPRTICSLLLLSMLWMDLAMA
  • Modification:  T23 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Ghrelin]: Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHSR
  • Target Unid:  A0A452E0S5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q6BEG7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006290_AF2.pdbhor006290_ESM.pdb

Physical Information

Mass: 283438 Formula: C110H173N31O32
Absent amino acids: CDEMRVWY Common amino acids: GLQ
pI: 9.7 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -0.43 Boman Index: -1248
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 93.48
Instability Index: 5942.17 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA